PPIST09691
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | STVPVAPPRRRRGRNLT |
| Peptide_Length | 17 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 5I22 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural Basis of the High Affinity Interaction between the Alphavirus Nonstructural Protein-3 (nsP3) and the SH3 Domain of Amphiphysin-2. |
|---|---|
| Release_Year | 2016 |
| PMID | 27268056 |
| DOI | 10.1074/jbc.M116.732412 |