PPIST11526
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | ASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | RSVKVKIKLGRK |
| Peptide_Length | 12 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 6BGH |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The BRD3 ET domain recognizes a short peptide motif through a mechanism that is conserved across chromatin remodelers and transcriptional regulators. |
|---|---|
| Release_Year | 2018 |
| PMID | 29567837 |
| DOI | 10.1074/jbc.RA117.000678 |