PPIST11895
Protein Information
| Protein_Chain | B |
|---|---|
| Protein_Sequence | MSMAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHH |
Peptide Information
| Peptide_Chain | A |
|---|---|
| Peptide_Sequence | DGGTTFEHLWSSLEPD |
| Peptide_Length | 16 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 6IJQ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Cytoplasmic pro-apoptotic function of the tumor suppressor p73 is mediated through a modified mode of recognition of the anti-apoptotic regulator Bcl-XL. |
|---|---|
| Release_Year | 2018 |
| PMID | 30429221 |
| DOI | 10.1074/jbc.RA118.003061 |