PPIST12617
Protein Information
| Protein_Chain | A[auth B] |
|---|---|
| Protein_Sequence | GSHMSLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVK |
Peptide Information
| Peptide_Chain | B[auth A] |
|---|---|
| Peptide_Sequence | XGKGGAKRHRKVX |
| Peptide_Length | 13 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 6O7G |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Selective binding of the PHD6 finger of MLL4 to histone H4K16ac links MLL4 and MOF. |
|---|---|
| Release_Year | 2019 |
| PMID | 31127101 |
| DOI | 10.1038/s41467-019-10324-8 |