PPIST12906
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MGWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | GAMEIIHEDNEWGIELVSE |
| Peptide_Length | 19 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 6H8C |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | An atypical LIR motif within UBA5 (ubiquitin like modifier activating enzyme 5) interacts with GABARAP proteins and mediates membrane localization of UBA5. |
|---|---|
| Release_Year | 2020 |
| PMID | 30990354 |
| DOI | 10.1080/15548627.2019.1606637 |