PPIST13312
Protein Information
| Protein_Chain | B[auth A] |
|---|---|
| Protein_Sequence | HMRALAELLSDTTERQQALADEVGSEVTGSLDDLIVNLVSQQWRRPPSARNGMSVEVLIEMLPDGTITNASVSRSSGDKPFDSSAVAAVRNVGRIPEMQQLPRATFDSLYRQRRIIFKPEDLSL |
Peptide Information
| Peptide_Chain | A[auth B] |
|---|---|
| Peptide_Sequence | ADPLVISSGNDRA |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 6S3W |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The lipoprotein Pal stabilises the bacterial outer membrane during constriction by a mobilisation-and-capture mechanism. |
|---|---|
| Release_Year | 2020 |
| PMID | 32161270 |
| DOI | 10.1038/s41467-020-15083-5 |