PPIST14937
Protein Information
| Protein_Chain | AA[auth 1]; A[auth 0]; B[auth 5]; DB[auth AA]; D[auth 6]; EA[auth C]; EB[auth D]; E[auth AB]; FA[auth H]; I; IB[auth M]; JA[auth R]; JB[auth S]; J[auth N]; KA[auth W]; OA[auth X]; PA[auth c]; P[auth b]; Q[auth g]; TA[auth h]; UA[auth m]; U[auth l]; V[auth q]; YA[auth r]; ZA[auth w]; Z[auth v]/BB[auth 3]; CA[auth 4]; CB[auth 8]; DA[auth 9]; GB[auth B]; G[auth A]; HA[auth G]; HB[auth K]; H[auth F]; IA[auth L]; LB[auth Q]; L[auth P]; MA[auth V]; MB[auth Z]; M[auth U]; NA[auth e]; N[auth a]; O[auth f]; RA[auth j]; SA[auth o]; S[auth k]; T[auth p]; WA[auth t]; XA[auth y]; X[auth u]; Y[auth z] |
|---|---|
| Protein_Sequence | MKKITLLLAGSALLLSGCAGVKSSFDCDATTSDTCMTMTKANQLARDKAAKQAGKPAAGGLPSLVNLPATSAVEVPSASRSAVTPPSGTRTVSTTPPVSAGTSAGVNTNTTTSTLTPRPVAGTPVTTTPSSVAYRPVVSVVTPTPSCQNVRCDNPGTVHPQRSRDQIATVWIAPWVDSDNAFHQPGRVSFVVSPADWVLPARVN/AQSPATISLPQGGQFRLSISNTDPNMIFIPGDKVTAITAPGGMLADKRLTTAGGVLFTSVATRTFTIFVETALGQTFSVVATPVKGEGRVYRLMSAEPPSRPETRKWETAQAYEKLLISLNRAVLTGDIPDGYGEVKPLSDGIRLPGGFSVTPLKAWAGDQLRADRYELRNANTWGVALREQDFWKPGVRAVMFDNNAQTLMGGGRMTVTVIRGNG |
Peptide Information
| Peptide_Chain | AB[auth 2]; BA[auth 7]; C[auth AC]; FB[auth J]; F[auth E]; GA[auth O]; KB[auth Y]; K[auth T]; LA[auth d]; QA[auth i]; R[auth n]; VA[auth s]; W[auth x] |
|---|---|
| Peptide_Sequence | PGMMDSQEFS |
| Peptide_Length | 10 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 7OKO |
|---|---|
| Method | ELECTRON MICROSCOPY |
| Resolution | 3.40 angstrom |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Architecture of the outer-membrane core complex from a conjugative type IV secretion system. |
|---|---|
| Release_Year | 2021 |
| PMID | 34824240 |
| DOI | 10.1038/s41467-021-27178-8 |