PPIST16156
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | SGGRATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQKGSEFPAGN |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | GMYPDPGLLSYINELC |
| Peptide_Length | 16 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 7XFG |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural mechanism of BRD4-NUT and p300 bipartite interaction in propagating aberrant gene transcription in chromatin in NUT carcinoma. |
|---|---|
| Release_Year | 2023 |
| PMID | 36690674 |
| DOI | 10.1038/s41467-023-36063-5 |