PPIDT00227
Drug Information
| Name | Liraglutide |
|---|---|
| Sequence | HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG |
| DrugBank_ID | DB06655 |
| Type | biotech |
| Indication | Saxenda, a formulation of liraglutide intended for weight loss, is indicated as an adjunct to diet and exercise for chronic weight management in adult patients who are obese (BMI≥30 kg/m2), or who are overweight (BMI≥27 kg/m2) and have at least one weight-related comorbidity. It is also indicated for chronic weight management in pediatric patients ≥12 years old who weigh ≥60 kg and have an initial BMI corresponding to obesity based on international cut-offs.[L38839] Victoza, a formulation of liraglutide used in diabetes, is indicated as an adjunct to diet and exercise to improve glycemic control in patients ≥10 years old with type 2 diabetes mellitus. It is also indicated to reduce the risk of major adverse cardiovascular events in adult patients with type 2 diabetes and established cardiovascular disease.[L38839] Liraglutide is also available in combination with [insulin degludec] as an adjunct to diet and exercise to improve glycemic control in adult patients with type 2 diabetes mellitus.[L38844] |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, solution | Subcutaneous |
18 mg/3mL
|
| Injection, solution | Subcutaneous |
6 mg/1mL
|
| Solution | Subcutaneous |
6.000 mg
|
| Injection, solution | Subcutaneous |
|
| Injection, solution | Subcutaneous |
6.0 mg/ml
|
| Solution | Subcutaneous |
600000 mg
|
| Injection | Subcutaneous |
6 mg/1mL
|
| Injection, solution | Parenteral; Subcutaneous |
6 MG/ML
|
| Injection; injection, solution | Subcutaneous |
6 MG/ML
|
| Solution | Subcutaneous |
6 mg / mL
|
| Injection, solution | Subcutaneous |
6 mg/ml
|
| Injection | Subcutaneous |
100 IU/ml
|
| Injection, solution | Parenteral; Subcutaneous |
|
| Solution | Subcutaneous |
|
| Injection, solution | Subcutaneous |
|
| Injection | Subcutaneous |
|
| Solution | Subcutaneous |
6 mg/1ml
|
| Injection, solution | — |
|
| Injection, solution | — |
6 mg/1ml
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P43220 | GLP1R | Glucagon-like peptide 1 receptor | Homo sapiens | agonist | Link |
| enzyme | P27487 | DPP4 | Dipeptidyl peptidase 4 | Homo sapiens | substrate | Link |
| enzyme | P08473 | MME | Neprilysin | Homo sapiens | substrate | Link |
| carrier | P02768 | ALB | Albumin | Homo sapiens | binder | Link |